PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_15013g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YC
Protein Properties Length: 224aa    MW: 25141.2 Da    PI: 5.5481
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_15013g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC27.47.1e-0912716464101
          NF-YC  64 lhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                    l  +enkrrtl+   ia+a+ rt  fdf vdivprde 
  MA_15013g0020 127 LTDKENKRRTLQNIGIATAIGRTGLFDFPVDIVPRDEF 164
                    6679*******************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MCSPVEGSDE IPNRGSYPNA SWYDTPVQVG NLRSEELGTW NRRINSNPQY HHDLKWGYDT  60
NPCIAPPIGG PPHPQLASYH QQLQAFWRDQ MRVVEVPNGV FQGMRDVHIE TDLEVMDSYR  120
LNVTDVLTDK ENKRRTLQNI GIATAIGRTG LFDFPVDIVP RDEFKDDGLV ILGAAGVLHF  180
MGSGDNVPSY YYVAQQAPNM TAYVPPTQQM RSKALAHVEG SLRT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0710914e-91BT071091.1 Picea sitchensis clone WS02770_F19 unknown mRNA.
GenBankBT1148344e-91BT114834.1 Picea glauca clone GQ03603_F12 mRNA sequence.
GenBankEF0818484e-91EF081848.1 Picea sitchensis clone WS02715_K12 unknown mRNA.
GenBankEF6783304e-91EF678330.1 Picea sitchensis clone WS02914_P18 unknown mRNA.
GenBankEU5794534e-91EU579453.1 Picea wilsonii HAP5B mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NKR83e-62A9NKR8_PICSI; Putative uncharacterized protein
TrEMBLB2LSM23e-62B2LSM2_9SPER; HAP5B
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31517117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.22e-14nuclear factor Y, subunit C2